NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212090_10554422

Scaffold Ga0212090_10554422


Overview

Basic Information
Taxon OID3300022561 Open in IMG/M
Scaffold IDGa0212090_10554422 Open in IMG/M
Source Dataset NameBorup_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)769
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameBorup Fiord, Nunavut, Canada
CoordinatesLat. (o)81.017Long. (o)-81.583Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010911Metagenome / Metatranscriptome297Y

Sequences

Protein IDFamilyRBSSequence
Ga0212090_105544222F010911GGAGGMESFTGTAVGALVSWSVDTDGHVFPANGGAADERYPHIVVDRNGVEWTVREVPTPQVWAKGVRCLVLNSRECVRRVWQYPREWRTLDADGLLRLGIAD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.