NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0236341_1039211

Scaffold Ga0236341_1039211


Overview

Basic Information
Taxon OID3300022591 Open in IMG/M
Scaffold IDGa0236341_1039211 Open in IMG/M
Source Dataset NameFreshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLaval University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1278
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location
Location NameSAS2a, Kuujjuarapick, Canada
CoordinatesLat. (o)55.1491Long. (o)-77.4866Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005167Metagenome / Metatranscriptome410Y
F019092Metagenome / Metatranscriptome231Y

Sequences

Protein IDFamilyRBSSequence
Ga0236341_10392112F005167GAGGMAVNSSRSMNASLDEGTTDGKYRKARPDTEVGMGSQDTLNNRQSLHAFYGYGFLTSEYPNKVNPGK
Ga0236341_10392115F019092AGGAGMSNVPLLGQKEVPQNEPMFRLLYCLVCKTLEELPPYDGVPEQDHLLAIACETHTFPSGEPHKGKLFVLPLRAWAKPESKKEIIRQIKGGGSAGLDELDDKFYESRSTFMEGAMECYQRHNKPKDGCHDWQDKSKLLIPNTVKERKAEGMAR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.