Scaffold Ga0236342_1008511

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0236342_1008511

Scaffold Ga0236342_1008511

Overview

Basic Information
Taxon OID	3300022592 Open in IMG/M
Scaffold ID	Ga0236342_1008511 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Laval University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3470
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (77.78%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location
Location Name	SAS2a, Kuujjuarapick, Canada
Coordinates	Lat. (^o)	55.1491	Long. (^o)	-77.4866	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000324	Metagenome / Metatranscriptome	1299	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0236342_10085113	F000324	N/A	MTVQTVAPVHTVTYDGATLNVYHANKGQGLPRHEHVYAHLTMCHAGSCLITKENKPLVMTKDTQPVNLIANEWHEIEVLEDGTVFVNVFAEGKY

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.