NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0236338_1041045

Scaffold Ga0236338_1041045


Overview

Basic Information
Taxon OID3300022593 Open in IMG/M
Scaffold IDGa0236338_1041045 Open in IMG/M
Source Dataset NameFreshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLaval University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1065
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location
Location NameKuujjuarapick
CoordinatesLat. (o)55.1491Long. (o)-77.4866Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002261Metagenome / Metatranscriptome577Y
F003186Metagenome / Metatranscriptome502N

Sequences

Protein IDFamilyRBSSequence
Ga0236338_10410451F003186GAGVINPKTILGERVTALQSCPDLVDALGGDGDNIRAFMEGLVTDNNLRLAILQMPPGSILVAWNGTTPRRLTGGSLHFAHRFSIYLRAPEQNSTATYADLFWLLVSAKPTDAPSWESLLHLQIDPDCFPMDMDLPSAQRNTVVVSADGATLDYFEVQATLVEQGNPGGE
Ga0236338_10410452F002261GGAMPNWPNIEAFVDGVISQTFGEPVVYQPVQAGAAHGSAFTVTAVRHLRVREESGAMANFEEISVNPADFSNPPAKGDWVTAWGAQYVVTTVRQPDAYGMLNLALLQRAS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.