Scaffold Ga0215184_1182378

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0215184_1182378

Scaffold Ga0215184_1182378

Overview

Basic Information
Taxon OID	3300022595 Open in IMG/M
Scaffold ID	Ga0215184_1182378 Open in IMG/M
Source Dataset Name	Metatranscriptome of coral microbial communities from Popa Island, Bocas del Toro, Panama - APAL T2 (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1104
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location Name	Panama: Bocas del Toro
Coordinates	Lat. (^o)	9.1956	Long. (^o)	-82.1254	Alt. (m)		Depth (m)	15
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094648	Metagenome / Metatranscriptome	105	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0215184_11823782	F094648	N/A	MLWFKFILGLRFLELVSILFAIVPDCGNEYTTKENKN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.