Scaffold Ga0236339_1158387

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0236339_1158387

Scaffold Ga0236339_1158387

Overview

Basic Information
Taxon OID	3300022650 Open in IMG/M
Scaffold ID	Ga0236339_1158387 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Laval University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1212
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location
Location Name	SAS2a, Kuujjuarapick, Canada
Coordinates	Lat. (^o)	55.1491	Long. (^o)	-77.4866	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019160	Metagenome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0236339_11583872	F019160	N/A	MNNMKLYLYYENVDRPLAIEIPDNEVDGFLQEYEEALHDTSVETFQWKNSGFRIAGLMAIVHEKHAPVRP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.