NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0251769_1001127

Scaffold Ga0251769_1001127


Overview

Basic Information
Taxon OID3300022692 Open in IMG/M
Scaffold IDGa0251769_1001127 Open in IMG/M
Source Dataset NameEnriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Alfalfa, Gen10, Rep 1, Penicillin and Streptomycin (Version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4513
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)34.4149Long. (o)-119.841Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F086383Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
Ga0251769_10011271F086383GAGGMTLHIALDGIYVNVNHIIVQKLVEYLTEKSYTVKTIFPLQDESIQSILAGYDLTFSEKAMIAALDRSITWNNQNFSNYDIVIWQTSILSSYVFHTDESVKPSFIKSINRFVPNMDIIVVVQPLGDKNQIIQKFNDVIKQFDNVYPVNFVNGAIDLTFKETIETIFEVLPTCNWCGRLFTKTTHFKKYCSKNCKDYAKEEQNRLNFRSYYKRYKDT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.