NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222623_10101604

Scaffold Ga0222623_10101604


Overview

Basic Information
Taxon OID3300022694 Open in IMG/M
Scaffold IDGa0222623_10101604 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1119
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9201Long. (o)-106.9487Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005457Metagenome / Metatranscriptome400Y
F040705Metagenome / Metatranscriptome161Y

Sequences

Protein IDFamilyRBSSequence
Ga0222623_101016042F005457AGGAGMSGEVSYNTHILIGVRSNGIKTVIADWPHVPKQAEVQKEIDAARNGYVAFALCTPTSILSGNGNENARGGWHRPAGPGRR
Ga0222623_101016043F040705N/AVDLNDLGENFEVKDDEYGSDPNTGYSIHSPSDARNHERPNHLRLFQEGWEPRSFQDRHEDANHIARVRAMERRNKQATQEFLPRWNEEEKQARDSRKKRTGSD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.