NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224563_1013756

Scaffold Ga0224563_1013756


Overview

Basic Information
Taxon OID3300022731 Open in IMG/M
Scaffold IDGa0224563_1013756 Open in IMG/M
Source Dataset NameSoil microbial communities from Bohemian Forest, Czech Republic ? CSU4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)680
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. S156(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameCzech Republic: South Bohemian Region
CoordinatesLat. (o)49.0427Long. (o)13.6161Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022768Metagenome / Metatranscriptome213Y

Sequences

Protein IDFamilyRBSSequence
Ga0224563_10137561F022768N/AMLNAQNMTRPMAFALQTTKIKLDTDRADTQSKIVSLYTPPLSGRPVKELVAEKQSREANEQKALDKLSRQNDWDVALSVGAHQQISPWVDSRGAYGEVSISYNLASHAINKHLDQAADAYDDWKKVQEGDVVRNAEILRDQLVNGISVQDSRLKALQEEQKEIESNLQLVGSADTTAALDFRNQLTTAQLLLRIEIGDASFRFELLREFLRRNY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.