NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228701_1009245

Scaffold Ga0228701_1009245


Overview

Basic Information
Taxon OID3300022746 Open in IMG/M
Scaffold IDGa0228701_1009245 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3934
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9255Long. (o)-83.5226Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000324Metagenome / Metatranscriptome1299Y
F011148Metagenome / Metatranscriptome294Y

Sequences

Protein IDFamilyRBSSequence
Ga0228701_10092451F011148GGALAVFNKNSITQVSGFNNPCITGELVYQQQTYWNLVLTAEDGVTPVSLTDAVIDAQIVRRTLTNVQDTRYGLSFDIGNYQPTPTPIPLTIVNRNDDAGSFTLVIDDNSWSLVDTDAEMAINSVNGAGFSGRIKISFPQVSATPPEDNIIFLLFIVRSDGIVKV
Ga0228701_10092452F000324N/AVIAINPRQDVTYDGATLRVYHANKGEGLPRHEHIYSHLTMVHAGSVLVTKEGKSLTMTKDTQPVNLVANEWHELEALEDGTVFVNVFAEGKY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.