NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228703_1032217

Scaffold Ga0228703_1032217


Overview

Basic Information
Taxon OID3300022747 Open in IMG/M
Scaffold IDGa0228703_1032217 Open in IMG/M
Source Dataset NameFreshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1549
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)33.9263Long. (o)-83.4268Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000447Metagenome / Metatranscriptome1128Y
F015208Metagenome / Metatranscriptome256Y
F038205Metagenome / Metatranscriptome166Y

Sequences

Protein IDFamilyRBSSequence
Ga0228703_10322173F015208GGAMYKITVANDGNPIHWEKEYSDELNAHTEFAKFVDWGFADEYSTVNLFTPSGKCYTKIFHRNGKVVIR
Ga0228703_10322174F038205AGGAMGNIAEIIAVACDECGGAGFLFWGNENNYDVEACECAVEDWNI
Ga0228703_10322175F000447AGGAMGYIEIFRINEEGAGWVDLSEATSEEMLDLEIGLFQEGAL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.