NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222673_1002606

Scaffold Ga0222673_1002606


Overview

Basic Information
Taxon OID3300022821 Open in IMG/M
Scaffold IDGa0222673_1002606 Open in IMG/M
Source Dataset NameSaline water microbial communities from Ace Lake, Antarctica - #801
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4997
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (90.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Ace Lake
CoordinatesLat. (o)-68.4725Long. (o)78.188Alt. (m)Depth (m)13
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018696Metagenome / Metatranscriptome233Y
F019616Metagenome / Metatranscriptome228Y

Sequences

Protein IDFamilyRBSSequence
Ga0222673_10026063F019616AGGAGMTKNPYVRLRELCGMSQKKFADKHDFGKMTMVYLESGMYTKVSDRQSIALGKECAQKGIDAKRFLQDEYGFSSLNQAYLAWRSEDRRVRAPSVLEKASLHFERGEDASPVAQFVTETTGSLQGFCKLLKVPSITMTRYMRGETVKVPDALLSALEDVKYPHAQALFEAQAAWQEQQ
Ga0222673_10026068F018696GGAGMTDEFEQFEGGVAVQGPAGTSLHIATPQGFTDTAFRGTLAAFHTAFMRNGKIPTVDEIYKLWPKLTKKVISGILGTSEFRDALDHRGIQWDVKDGLTMQQQTVLLKLSDPFDRRALATKLKDLTVPMPRFQAWLKQPLFFEMYNKQTQQNYTEALPAIRQRLIGNAESGDQRAIELVFAMTGEWNPQQQHLDDARTIILKVVEAIITHVKDAKVREAILADVSLYAGTISTIGHTKSLES
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.