NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222646_100059

Scaffold Ga0222646_100059


Overview

Basic Information
Taxon OID3300022822 Open in IMG/M
Scaffold IDGa0222646_100059 Open in IMG/M
Source Dataset NameSaline water microbial communities from Ace Lake, Antarctica - #293
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)42530
Total Scaffold Genes70 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)60 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Ace Lake
CoordinatesLat. (o)-68.4725Long. (o)78.188Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005796Metagenome / Metatranscriptome390Y
F025150Metagenome / Metatranscriptome203Y
F047922Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0222646_10005922F047922GAGGMILPVLEMNPQEIVLHKAQWMMANYYESHTHTDLRKDALEWCKAHCFQWRFDFKRFTDVYADTVRFELEEDFTAFNEWYRGRWDV
Ga0222646_10005924F025150GGAGMINVYTEGNCLKDYTTFIDECIMALFPEDAKYDIYIEVEKFVDEDGSHAGFCLGDSKDCVISLATHWVYEDGEEIAYEPHELASNIAHELVHAKQFCKNQINMIDNVWKHNNVVLNCDEIEYEELPWEVEAYTYEVFLTDILWENV
Ga0222646_10005927F005796AGGAGMLEYSVFVFCLIGCGLTCHALGKQEGIECTIEHLVDNGMIELDEE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.