Scaffold Ga0222641_1000253

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0222641_1000253

Scaffold Ga0222641_1000253

Overview

Basic Information
Taxon OID	3300022828 Open in IMG/M
Scaffold ID	Ga0222641_1000253 Open in IMG/M
Source Dataset Name	Saline water microbial communities from Ace Lake, Antarctica - #227
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11094
Total Scaffold Genes	19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (47.37%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Antarctica: Ace Lake
Coordinates	Lat. (^o)	-68.4725	Long. (^o)	78.188	Alt. (m)		Depth (m)	24
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010230	Metagenome	306	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0222641_10002531	F010230	GAG	MPLLVLINGNEVRLVQLFQVKAKLVPLLVSINGNELRLVQFRQVSPKLVPLLVLINGNELRLVQLYQVKAKLVPLLVSINGNELRLLQSRQVSPKLVPLLVLINGNELRL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.