NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222711_1018150

Scaffold Ga0222711_1018150


Overview

Basic Information
Taxon OID3300022837 Open in IMG/M
Scaffold IDGa0222711_1018150 Open in IMG/M
Source Dataset NameSaline water microbial communities from Ace Lake, Antarctica - #1699
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)971
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Ace Lake
CoordinatesLat. (o)-68.4725Long. (o)78.188Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003677Metagenome / Metatranscriptome474Y
F076257Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
Ga0222711_10181502F003677AGGMVDEALCLFHSDVDKEIYEVENEITYVTKWQVIAKNRDEAFDIWLENHKLNMSTEDSKNTVCSYAKDYSQMGAIKKIAKIKYNEESDEVYADES
Ga0222711_10181503F076257N/AKEKLKLTKLHEDVRNNYNDREKFANEMDSTLLEKTSKLDNSINDLEGKLENWKKVRKWDTEIERSLIKHPDELDRLLKKICHEETSRDFYSGPRGKALQMLDLSKEYCKNLLNAGQSLATVWGVVGQEMAKEKINTSTVPKPEFLAITK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.