NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224549_1000503

Scaffold Ga0224549_1000503


Overview

Basic Information
Taxon OID3300022840 Open in IMG/M
Scaffold IDGa0224549_1000503 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5492
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3535Long. (o)19.0472Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013663Metagenome / Metatranscriptome269Y
F014996Metagenome / Metatranscriptome258Y
F029532Metagenome / Metatranscriptome188Y

Sequences

Protein IDFamilyRBSSequence
Ga0224549_10005034F013663GGCGGMNTRPDRDGDEQLRLLDAAWEEAARYWRDEVARQFAADHWTPLAQQARAYLEALRALMDMLETAERETDF
Ga0224549_10005035F014996GGAVTWVGSGGTNRVHADIDALKGFHEALVRFRYAQRAVAERGDDEIEMTRASLAAKASHWQAQLEQRQADLDACRARSGATTDCSAYAWAVEQAAERLEHVRRWQQRVDTEASEFGGTASAFLDLLENDVPRAERQLLALIASLEAARRVQAGGGLPV
Ga0224549_10005037F029532N/AGLLWAKVVGSTMALARALLDRGDWGGVRRLASFLADAGEDSTAAELKIQLGKAVWGTYHEQLQGISNAMRPAAIGEAIDALRAVLREVPEDVPDRNREVNRFLAPLAASVHAIMREQEMDIPYSSRVEHIAVGGVARYPDIVKLSLDEIAAEFEASASGLVINKQENRHVRGYQRS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.