NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224528_1000107

Scaffold Ga0224528_1000107


Overview

Basic Information
Taxon OID3300022861 Open in IMG/M
Scaffold IDGa0224528_1000107 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T25
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)67897
Total Scaffold Genes60 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)43 (71.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3529Long. (o)19.0475Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F074276Metagenome / Metatranscriptome119Y
F093076Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0224528_100010711F093076GGAGGMNGAANNNPYLYASYIVVWVIHIAYAFTLVSRSKRMKRETRELNRQ
Ga0224528_10001074F074276GAGMRGRKARYTFVIEILGGTYVHQASGESPELALRAWLRQATDEDFEWATHRVELMHALEDEVAAPVDGCRNVWCLSGLAADHLFLIHIISTESGPSAGNAIAEAQLERIGADPKLWGWSDR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.