NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0222628_1049349

Scaffold Ga0222628_1049349


Overview

Basic Information
Taxon OID3300022871 Open in IMG/M
Scaffold IDGa0222628_1049349 Open in IMG/M
Source Dataset NameSaline water microbial communities from Ace Lake, Antarctica - #95
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)687
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location NameAntarctica: Ace Lake
CoordinatesLat. (o)-68.4725Long. (o)78.188Alt. (m)Depth (m)13
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010230Metagenome306Y

Sequences

Protein IDFamilyRBSSequence
Ga0222628_10493491F010230N/AQVEVKSVPLLVLINGNELRLLQFFQALGKSVTLLVSINGNELRLVQFSQVEVKLVALLVLINGNELRLVQFSQAKRKLVPLLVLINGNELRLLQFRQVESKLVPLLVLINGNELRLVQFHQVSLK
Ga0222628_10493492F010230N/ALLVSINGNELRLVQSRQVELKLMPLLVLINGNEVRLVQLFQVKAKLVPLLVSINGNELRLVQFRQVSPKLVPLLVLINGNELRLVQLYQVKAKLVPLLVSI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.