NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247768_1000016

Scaffold Ga0247768_1000016


Overview

Basic Information
Taxon OID3300022910 Open in IMG/M
Scaffold IDGa0247768_1000016 Open in IMG/M
Source Dataset NamePlant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L016-104C-6
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)168636
Total Scaffold Genes173 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)125 (72.25%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003627Metagenome / Metatranscriptome476Y
F049823Metagenome146Y

Sequences

Protein IDFamilyRBSSequence
Ga0247768_1000016125F049823AGGAVPPQPVQGSFEVARGVIPQERIDDALRLLHLDLLQRGASAEELGEWLWGMHWFPHLKEREEILALAQSLPEEWRTGRPCEPQILLQFPHTGPAPEIEFHLDQEPPWAGDSTYLRIVGVPLSPWRGDNGGLLVKTADGPAPVEADPGDAIVMSPDLPHSGGVNLTGALRYGVYFRWLSE
Ga0247768_100001626F003627N/AMDRETARQNMRAGLVAGGIAAGIFALSFVAAFLYIAQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.