NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255770_10002925

Scaffold Ga0255770_10002925


Overview

Basic Information
Taxon OID3300022937 Open in IMG/M
Scaffold IDGa0255770_10002925 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15012
Total Scaffold Genes25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (16.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015588Metagenome / Metatranscriptome253N
F025493Metagenome / Metatranscriptome201N

Sequences

Protein IDFamilyRBSSequence
Ga0255770_1000292511F025493GAGMVTTARYTQPELRHAMETLDDEVFYAVYRWIMENDTEFDKMGVEMLGMTNSQSIGIASEVIEALLKFSQHTCQEEIKDYTASLVCFTDSTVYALLVNVDKERFGARRFAKFIYTTLMNALKRDLLENLYVLI
Ga0255770_1000292520F015588GAGMDTLPSDLVHNIFTRACMMEMEEKFPLNYRFYTDNSEIEFSSNDLVVRRDRVIADLSNFVYNHIFTSMRLPILHFEKRIGNKVVYSQHVHLWNDEIIQRHTGKIPKSPLESYLWNMMMLI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.