NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224560_103955

Scaffold Ga0224560_103955


Overview

Basic Information
Taxon OID3300023019 Open in IMG/M
Scaffold IDGa0224560_103955 Open in IMG/M
Source Dataset NameSoil microbial communities from Bohemian Forest, Czech Republic ? CSU1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)951
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameCzech Republic: South Bohemian Region
CoordinatesLat. (o)49.043Long. (o)13.6183Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000092Metagenome / Metatranscriptome2385Y
F004042Metagenome / Metatranscriptome456Y
F015246Metagenome / Metatranscriptome256Y

Sequences

Protein IDFamilyRBSSequence
Ga0224560_1039551F015246N/ASQDDRIAGVTQNGSGGDSLLAGVTSYFGLRPGTHVWLGIDWDVAHSTGEMFMPVRRHISFGITQQFRMHLW
Ga0224560_1039552F004042AGGAGGMNRKNLALLALLCLTAVPATQAQIKHIEMRVEGMT
Ga0224560_1039553F000092GAGVKQHLGRQSGVQNVEVSLIDGKVQVTPKEDGQIDPAQLPKATYDSGVTVAEMTMTAQGKIAKDSSGNLVLQIGPNQPFAIEPNELSKGLESLVGSQTAVTVRGQLYKKPAGKKKADASAPLKLLLLEIQKKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.