NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224555_1017946

Scaffold Ga0224555_1017946


Overview

Basic Information
Taxon OID3300023088 Open in IMG/M
Scaffold IDGa0224555_1017946 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3605
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0474Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000451Metagenome / Metatranscriptome1124Y
F018347Metagenome / Metatranscriptome235Y

Sequences

Protein IDFamilyRBSSequence
Ga0224555_10179461F018347AGGMADQAERVILEAEDQVTPITDKANAALDGFEKKAESSHGKVIRISDQTRSSVQRLIASLEKQAETYGKSGVDRLITQRDQLLQRYNREPQAIDAITRSYEKMIAMEEKAAREALAVKAAKEAEEALRKQSEAITSF
Ga0224555_10179462F000451AGGAMERFQTVIRRARFVYSPYTATEMQGFAQVLADSIRVRIQSGQNIYDQAAAPLKPGLAGRRGYPDYKSARGLNPIRDWTWSGHTLRCLKVLTANENRAAIGFLDEALPGRRMTASQIAAFNNRREAQWGVSPRDRQAVLAAFQARPFVMLKAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.