NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224558_1000327

Scaffold Ga0224558_1000327


Overview

Basic Information
Taxon OID3300023090 Open in IMG/M
Scaffold IDGa0224558_1000327 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)55999
Total Scaffold Genes57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)34 (59.65%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0475Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000780Metagenome / Metatranscriptome895Y
F001734Metagenome / Metatranscriptome644Y
F003010Metagenome / Metatranscriptome513Y

Sequences

Protein IDFamilyRBSSequence
Ga0224558_100032741F000780GAGMDRQIENGKGRTTSGAKRPYSSGHLMCRTPLWGVAGFIGCAYFAWISFSHVTRNEYEWPHDVWTAATYIVWILLLAALALDTRCLRERVFFALLFINFVAGCGLTLWRNIPPADVRTARIGTGALWALAALVSLTTLRTAPELRGNDARHQ
Ga0224558_100032748F001734N/AMRSRLPSFRLVALCLLVFVPVLASLFPLAASAQDEAPSLGDLARNLRKNKTQQPQQQPDAARTVIDNDNLAQVMEDAKKARPVKQDKTVFSIDPSGNALKMSSPDVTCSLSFNARASSLLVKPVLIEDLPLTELLKLDGPGSIQDENLQLEVFNGTDWDIREITIGLTLERKPGENAKVAAGARVIPAAQNNAPVAVERRSDVTLLYHLKAAAKPFSTTTFHENIGITPGPDEDWRWSIVEAKGIRPSQAPSAPNSLRGPGLTPQR
Ga0224558_100032752F003010GGAMISSKFGAENTEMAKVAKKKNALLESVPALVLLGLLAGAVGGLGIGLIQLRAMSQTASSTAGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.