NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224558_1003281

Scaffold Ga0224558_1003281


Overview

Basic Information
Taxon OID3300023090 Open in IMG/M
Scaffold IDGa0224558_1003281 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13650
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (82.35%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0475Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000065Metagenome / Metatranscriptome2788Y
F000272Metagenome / Metatranscriptome1408Y
F017681Metagenome / Metatranscriptome239Y

Sequences

Protein IDFamilyRBSSequence
Ga0224558_10032812F017681N/ALANVLKVSIIEHFPAVDTLHYGIVKIKDLTLKQIQSVPCPTCGAAIEKACELHTGALRTEPHRDRKLSAAEAVETKSGKC
Ga0224558_10032816F000065AGGMTHISNNPTPKLHKAPQPPLSHPGATPDSDRAKRPALAEPPASDQELSPGDRVESLGNFGKPTGVFGTVEQANEDDAVVKWDDDGRVRLHQPWLKKV
Ga0224558_10032818F000272AGGAGGMAQSVLDRTAEQIAESAHQASRATSAVADAIEDGVGVVRRAAKEGGDAAEEFLNDTTQRLQRHPALTIAATFAVGFTAGTLIGWIMKRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.