NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224558_1003410

Scaffold Ga0224558_1003410


Overview

Basic Information
Taxon OID3300023090 Open in IMG/M
Scaffold IDGa0224558_1003410 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13271
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (80.95%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3532Long. (o)19.0475Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011360Metagenome / Metatranscriptome291Y
F020937Metagenome / Metatranscriptome221Y
F037387Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0224558_100341016F011360N/AMTTYGEWIKKSARIGALLGGVAGFFYGAYIMATNLTLGWTDVLDTMGSVATVLIFAVILGSLCIGIGGLAGMVLGVVASPLSSLHFRRSRYFSG
Ga0224558_10034106F037387GGAGMGISNPEIQKKVFGPRWEHEIEKQRWPFWKRLMHRLQDCPICKPKSQTRKLQ
Ga0224558_10034108F020937N/AMKTYAHELAHHYEHRKNVISFSSASLFQSLITASVIGVVAAFIGVALNAVRWYGNTSWYVGATVAAVVEAVVVTALVTIVIEQRRKRSIRRTLELAFLNHHIRNAITQMSMVQYVTDPQQHERLVREAVGRISEALFRIANSADLTGLSVEVDLKGIQLTHEGEAREQEEKKKVS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.