Scaffold Ga0247741_1001541

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247741_1001541

Scaffold Ga0247741_1001541

Overview

Basic Information
Taxon OID	3300023094 Open in IMG/M
Scaffold ID	Ga0247741_1001541 Open in IMG/M
Source Dataset Name	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L213-509R-2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12791
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (72.73%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	43.3	Long. (^o)	-89.38	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020721	Metagenome / Metatranscriptome	222	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247741_10015412	F020721	AGGA	MSNTEMLETISADQLTTASGGVSMKLTQYGYPNDPYSDSETRKGHGAYRNLDREHSMAITDSGLRALGLSRQGVRANPTWVDIKLKGGGTLQRRIDDRAPQGDMRADLYQPHGFDRGLPDRAEISLHR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.