NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255762_10028068

Scaffold Ga0255762_10028068


Overview

Basic Information
Taxon OID3300023119 Open in IMG/M
Scaffold IDGa0255762_10028068 Open in IMG/M
Source Dataset NameCoastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3698
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.972Long. (o)-81.028Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004712Metagenome / Metatranscriptome427Y
F066802Metagenome / Metatranscriptome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0255762_100280682F004712AGGAMPINTITTSQAPDAKPVAVNKVVSTNWQVLIEVPQYEVPELVFGGSTTVEPGVGEVISPLILCNTTANTVNIDVRTHREDVNAEFYILRSMPIPGYQTTAIPLNGQFLKSGDTLEILADTDLAVHSTLSFTLGQSEEDDVV
Ga0255762_100280683F066802N/ATASFFNYDGTHVFPVFNPTMQGLKYKGSVAQLSDLASITGQKPNWAYIVATDLTTSFYAGNIYYWDGSTWVLEGANNTDLLDAFVGAWDRMRDYIVNNLSPNSEHSLMVEGLFNDCLKDNVLRPETLVFGALVESIAHQFNGASAGVNRNALPLNFRNLGAAISAVASVLNEDGGRIRWSGADELNNQYFARGLRINGRTGRIEGRPFTSSVRKLARRASNSRASL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.