Scaffold Ga0214921_10009879

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0214921_10009879

Scaffold Ga0214921_10009879

Overview

Basic Information
Taxon OID	3300023174 Open in IMG/M
Scaffold ID	Ga0214921_10009879 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11940
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (8.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location Name	USA: Georgia
Coordinates	Lat. (^o)	34.2611	Long. (^o)	-83.95	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F022816	Metagenome / Metatranscriptome	212	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214921_100098794	F022816	N/A	MNAIQELFAPLDKDYCLLFYWLTVANFIFLAVAALGFVSSLVLLFRGKITIMSGLYSFLMILVYALMYFQTRLFYSMCVTSNMKAGTYGMGSPSDSLPAVAQQASGAAPGAYRM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.