NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214921_10098511

Scaffold Ga0214921_10098511


Overview

Basic Information
Taxon OID3300023174 Open in IMG/M
Scaffold IDGa0214921_10098511 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2209
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (25.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007859Metagenome / Metatranscriptome343Y
F008688Metagenome / Metatranscriptome329N
F009135Metagenome / Metatranscriptome322Y
F010081Metagenome / Metatranscriptome308Y

Sequences

Protein IDFamilyRBSSequence
Ga0214921_100985113F010081N/AMKEQIDSIIKKHCLKMQEVDKTKSIPMTVKELDIIVYNMYRELYGLRDIRSSNYNLNSFTAENKKGHCS
Ga0214921_100985114F007859N/AMKSLLIATLLFTGCTSGMYLRYSYNRALETLPKCSTVRAINNRYITYSMIEHSTNNVYVIYTNYYKAYYNVSGDITKTTKN
Ga0214921_100985115F008688N/AMNRFNKIVLGSLAAILLTAMTVNPPKIKVYLIMSYRGNDLAIEKVYLKKENAQKYCDMYKDSHNYSVEEKELTE
Ga0214921_100985117F009135AGGMTGKPKYYLKVNLPTTFDDLDAEVIKKDLITYINSRNQYGALYGPKSSKKGIVVEKIIYSTNED
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.