NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214923_10030018

Scaffold Ga0214923_10030018


Overview

Basic Information
Taxon OID3300023179 Open in IMG/M
Scaffold IDGa0214923_10030018 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4555
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037078Metagenome / Metatranscriptome168N
F043789Metagenome / Metatranscriptome155Y
F086551Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
Ga0214923_100300183F043789N/AMKKKLSKYEQLIANLDKAAQGLKDASAHAVATLEAHAQKIEEINQKYSTTATK
Ga0214923_100300184F037078N/AMKNQITITTQTFGNTNAFLLEGNKKQIENFHNAMYNYSATNGELHDMGNGKAFYFYAQPEAVLEAMTKVALYALCNKIKAKGMKGGLLALAKQKAQAKFDAIKEGRFLRTAESGDTYNLGTITAERPSDYCGAISNGRD
Ga0214923_100300187F086551AGGAMNTQINPELYENKNIYRYGHDKLLVKIFPSTIGWKTKTATAEILEGEDKGKWTTIYMRKGLYPVDAQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.