Scaffold Ga0255842_1182190

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0255842_1182190

Scaffold Ga0255842_1182190

Overview

Basic Information
Taxon OID	3300023211 Open in IMG/M
Scaffold ID	Ga0255842_1182190 Open in IMG/M
Source Dataset Name	Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? CA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Argonne National Laboratory
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	4411
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Ppcp Degradation By Aerobic Enrichment Cultures (Carbon Source)

Source Dataset Sampling Location
Location Name	Fort Collins, Colorado, USA
Coordinates	Lat. (^o)	40.585258	Long. (^o)	-105.084419	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020435	Metagenome	224	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255842_11821902	F020435	GGAGG	VIRFSELVSALSPTQYAELALLLFLAVFAGVAIRHGGKRRAVEHAEASMLPLADDAGELR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.