NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247760_1000029

Scaffold Ga0247760_1000029


Overview

Basic Information
Taxon OID3300023272 Open in IMG/M
Scaffold IDGa0247760_1000029 Open in IMG/M
Source Dataset NamePlant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L171-409R-4
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)121782
Total Scaffold Genes110 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)81 (73.64%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046467Metagenome / Metatranscriptome151N
F065927Metagenome127Y
F076755Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0247760_100002967F076755GAGMHAVVKGMVQVHSVTYRIVRVSAGHYDVVRLLDDVRVGMFSLGTRREPIIEGDAPEVIREVARAALQGGRTTWAPRRLLA
Ga0247760_10000297F065927GAGGMAPNTRPVLKSIESSPVHPFQALDHFVTSGGMRVSYYALALDQVPVDFFADPDGTWSYELLSRAAGFASHSGVAIGALKAEFNGHPEGAAVVTLNALTRPYVAIVECPIAYEYLEPSESSASSAA
Ga0247760_10000298F046467N/AVSDLRDPDRDPDHLLAPERLIELENAAEPARQRLSELPAPALALVQAWLAAELSVARERALEVADFEFAECVCEMEQRLRFPGSFMRDAQASLRIQAVLGARAQFRVIQGGG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.