Scaffold Ga0222670_1004220

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0222670_1004220

Scaffold Ga0222670_1004220

Overview

Basic Information
Taxon OID	3300023294 Open in IMG/M
Scaffold ID	Ga0222670_1004220 Open in IMG/M
Source Dataset Name	Saline water microbial communities from Ace Lake, Antarctica - #732
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3885
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Antarctica: Ace Lake
Coordinates	Lat. (^o)	-68.4725	Long. (^o)	78.188	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085476	Metagenome / Metatranscriptome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0222670_10042201	F085476	AGG	MIKLNISKKDYNKIKFKTHHDQLRLIRHEYSNYDSVINDTNWKYVTVKFVNQIAIHFPALINAAKQWAEYKTTNFVR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.