NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256721_106347

Scaffold Ga0256721_106347


Overview

Basic Information
Taxon OID3300023312 Open in IMG/M
Scaffold IDGa0256721_106347 Open in IMG/M
Source Dataset NameHuman gut microbial communities from healthy child feces in Northridge, California, USA -- CDI_12C
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Irvine
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5005
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (18.18%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome

Source Dataset Sampling Location
Location NameUSA: Northridge, California
CoordinatesLat. (o)34.2381Long. (o)-118.5301Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076653Metagenome118N

Sequences

Protein IDFamilyRBSSequence
Ga0256721_1063475F076653N/AMTIEDKYLGWKDLFFDRFVHCYDDIDQPPGSNIPLAKINFDNNTGYVEDGTINIAELLQYLRIHNKVYGHDYNPLEIFFVLQTLERLVEGAKEIFKDQPGVQDMPTYKGFFIRDDFSRGKDYALDLDKIVSGMGGWYGEDEDPCYSMFVSQDQIWNLNPILKVLADEGSPLAKKLGYEINSYVSDNGYTIYNPYLSWINHYYHYCPTFNEDKLKPWDRVEDRKNKFKMTDKVKRGANNWYYSGGTISCVDNFMGKRYRKNLRTFIYRGIVFFLDRIWHTPLFEKMGVKMKYNAYYCYAATSGIWYNKGFKKRLAKRFNESLRGGGDLFGANLACMVCDRRDIDWEALRLWLDKYDEPTDKGMVNSPIQFMYLYLYYAFNK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.