Basic Information | |
---|---|
Taxon OID | 3300023312 Open in IMG/M |
Scaffold ID | Ga0256721_107369 Open in IMG/M |
Source Dataset Name | Human gut microbial communities from healthy child feces in Northridge, California, USA -- CDI_12C |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of California, Irvine |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4300 |
Total Scaffold Genes | 8 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (62.50%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Northridge, California | |||||||
Coordinates | Lat. (o) | 34.2381 | Long. (o) | -118.5301 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088920 | Metagenome | 109 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0256721_1073694 | F088920 | N/A | VSANLHHYPAFEAGLILHLILHLILHFSQKAAIFAPKRAFSFLFVPTLFFVGLSVLSPQTSLKISGQASLY |
⦗Top⦘ |