Scaffold Ga0257022_1046431

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0257022_1046431

Scaffold Ga0257022_1046431

Overview

Basic Information
Taxon OID	3300023481 Open in IMG/M
Scaffold ID	Ga0257022_1046431 Open in IMG/M
Source Dataset Name	Marine microbial mat from Loihi Seamount, Hawaii, USA - Ku'kulu Base Individual Assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Western Washington University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	758
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa

Source Dataset Sampling Location
Location Name	Loihi Seamount, Hawaii, USA
Coordinates	Lat. (^o)	18.903	Long. (^o)	-155.257	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032311	Metagenome / Metatranscriptome	180	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0257022_10464314	F032311	N/A	IKKRKLARFPVNATDDIKMRMKPNKPAFKFPSPTGSMMIHVYLRKMAPSKGQPKGMMAYNYQLEDK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.