Scaffold Ga0257045_106888

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0257045_106888

Scaffold Ga0257045_106888

Overview

Basic Information
Taxon OID	3300023491 Open in IMG/M
Scaffold ID	Ga0257045_106888 Open in IMG/M
Source Dataset Name	Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_28A
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of California, Irvine
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3720
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome

Source Dataset Sampling Location
Location Name	USA: Northridge, California
Coordinates	Lat. (^o)	34.2381	Long. (^o)	-118.5301	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071325	Metagenome	122	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0257045_1068884	F071325	N/A	RFHKFQYCSIFKVLLALLLDSSIIISKVVLFVKHFFDIFLSFPNAFLKAFHPHAVRFPAAFLLVHRFYLAFEELLSCATAYL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.