 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300024062 Open in IMG/M |
| Scaffold ID | Ga0255039_10002468 Open in IMG/M |
| Source Dataset Name | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Restricted |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 6216 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (12.50%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Strait → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Canada: British Columbia | |||||||
| Coordinates | Lat. (o) | 49.2166667 | Long. (o) | -123.5333333 | Alt. (m) | Depth (m) | 200 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F012963 | Metagenome / Metatranscriptome | 275 | Y |
| F099108 | Metagenome / Metatranscriptome | 103 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0255039_100024681 | F012963 | N/A | GTDAGGAIAGVAQPFILDEPTGTLVGGVAVDANIGSFITAVELETGLSDGRSQRLYSGVSTISSTVNYRGVYDSGNSGPAQLDFFAQFTILLSLNSRGTNVWSVSV |
| Ga0255039_100024687 | F099108 | N/A | MSIKIISGHVVFNENAVVMSKKFDWNLENDFNPQAGDLYIVFGGHELAHQLLEVQFRKNSSFGYIIMNSEQINSQFFRNKYYIQLMKRNVVFDYNTITSDYLKKAHEVKCLSFYFFEFMKFNSETNDRPYDITFIGSKTEDRVKLMKDLEEEFNDLKFYVDFDWKHASPQSMTDVLQKSKVVLNLAYYTQSRPLESHRINKALACECDVVSTLSDDHDANDFYKDYCYMTDDVKNTLHKYFNEELDKKKPYEELVKELSQKFNPHMKFIIDHIHKKLLSLSNTNESATEVVSQQTTSDSDIPTNTETEEQVGESV |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |