NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247695_1059837

Scaffold Ga0247695_1059837


Overview

Basic Information
Taxon OID3300024179 Open in IMG/M
Scaffold IDGa0247695_1059837 Open in IMG/M
Source Dataset NameSoil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK36
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)561
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)40.4449Long. (o)-87.0297Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079074Metagenome / Metatranscriptome116Y

Sequences

Protein IDFamilyRBSSequence
Ga0247695_10598372F079074N/AMPRHTKAKNVAIAIRPERKERVTITLSRDSVEYVRTISAKERTHVSTVMERLIESARRAEELKQLNSGISAYYDALPDAGVAEDAAWGQLGAAGLAAFVESEGDETISD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.