NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228668_1000471

Scaffold Ga0228668_1000471


Overview

Basic Information
Taxon OID3300024180 Open in IMG/M
Scaffold IDGa0228668_1000471 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 82D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16923
Total Scaffold Genes42 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (4.76%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001217Metagenome / Metatranscriptome745Y
F045106Metagenome / Metatranscriptome153N
F104912Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0228668_100047129F001217N/AMSKTKFNGFEKYFIQTALRHAIEEAEKDVLATESEGKRSLYAPGYFTMVGNEIIDKVNSMTLKKYQD
Ga0228668_100047135F104912N/AMMTMKEVCAYVAQKRKADAIHHRKTVTQGEYCSGLTAKEYRKVKTKGKGSGSKGRSFSHTKLWNHYNQPVTTN
Ga0228668_100047136F045106N/AMKPKNVEFIEEFIEILGGDNFFLCDLIDQEELFTMQGELAQLICDHANNGTSVARHLVPLLPNTFKVE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.