NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224568_1007915

Scaffold Ga0224568_1007915


Overview

Basic Information
Taxon OID3300024220 Open in IMG/M
Scaffold IDGa0224568_1007915 Open in IMG/M
Source Dataset NameSpruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1021
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location NameCzech Republic: South Bohemian Region
CoordinatesLat. (o)49.0448Long. (o)13.618Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019446Metagenome / Metatranscriptome229Y
F034658Metagenome / Metatranscriptome174Y

Sequences

Protein IDFamilyRBSSequence
Ga0224568_10079151F034658GAGGMKSVGGIHRTRLAASKVHRHLVKEARRTVQELGWQVPEDDMSPTLVGAIPLPFPVPDSFETAFGYKGNLRFVQFGYTAGSPQFGYSDGGDDLPSDGSLWSWFLHHP
Ga0224568_10079152F019446N/ALDLRKYGTTVTDAENQFLENMPDEIKEVVRWHADALSRGRASQSIADFAGRFLGGMYEDGAVLPTNLSASAPEVLALVLLQHRTSPRSTGAWLNLGFALRRVALYRTQDPEETNRARLQSAVQAFDRALDLDPDNNGKNIRTWTGMSLAYHMLDMYEKELECCARALESDRSDPKLWLLYSFALKSAGREDEALSTMNDAYEAYIRAGKPDELREVFADVQSTTQRPCRQRMAQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.