NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247724_1002915

Scaffold Ga0247724_1002915


Overview

Basic Information
Taxon OID3300024239 Open in IMG/M
Scaffold IDGa0247724_1002915 Open in IMG/M
Source Dataset NameSubsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2874
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)35.7Long. (o)-98.594Alt. (m)Depth (m)3933
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032254Metagenome / Metatranscriptome180N
F040465Metagenome / Metatranscriptome161N
F081269Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0247724_10029151F040465N/AMSDEEVDECAQWPEITEEELSYAQDIWNREPSPDEERLDDWLLVMEEIVGIIGYTYHSIFQLLESTNVNNNCLLEALRALYIFAMAEVNVAKRKRTSS
Ga0247724_10029152F032254N/AMCVRKVGYRVAEKRFVAIPRLPPPSDKDAMSKFVVDTLCSNRACRYRPDVPMVQSLAQCTRSCGNPSCFYQSCHVVLVLDPSPKLYRDVLDVYKG
Ga0247724_10029153F081269N/AMEALPVAVSGSLYKSALTMIKELKKLVIKLTREGVSCSPSVIQMFDETKRWFMERIRVHFADSQKRYLQWRWRAAEKMFLQFKDGKPLTSVAATVVNVAASPAARRPRKRVKVAAAAAPSNLTVIPE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.