NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247724_1008497

Scaffold Ga0247724_1008497


Overview

Basic Information
Taxon OID3300024239 Open in IMG/M
Scaffold IDGa0247724_1008497 Open in IMG/M
Source Dataset NameSubsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1536
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Oklahoma
CoordinatesLat. (o)35.7Long. (o)-98.594Alt. (m)Depth (m)3933
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026798Metagenome / Metatranscriptome196N
F073066Metagenome / Metatranscriptome120N
F085120Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0247724_10084972F026798N/AMDKSKEKLISHNCTEESSKSKRGNNVNIDKVIDENNQLTTIEKLALRRGIERVNRRRDSQQAKIIRMVNLLDVKQNFQDMNNQLKLQMLFNTVLKLKRVYPSKSAMWKAPSNNTLPPYKSVRLENKLLKRGLRKKCSSYPNKEKIIENWYRLMKVQESL
Ga0247724_10084974F085120AGGMNNQARIIQLLNRLENMLKIEMEKARTDRDKDAIKLLEKLYNLIKKTEVNYSAQKH
Ga0247724_10084975F073066N/AMEEDLRKIHLEDLLKTLEDSDKDKKIEICNIMKEMVKEEIEKAKRSQNNDMTHFLDKLKELLEKTINRYSE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.