 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300024239 Open in IMG/M |
| Scaffold ID | Ga0247724_1045562 Open in IMG/M |
| Source Dataset Name | Subsurface sediment microbial communities from gas well in Oklahoma, United States - OK STACK MC-2-E |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 648 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Branchiopoda → Phyllopoda → Diplostraca → Cladocera → Anomopoda → Daphniidae → Daphnia → Daphnia pulex | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Oklahoma | |||||||
| Coordinates | Lat. (o) | 35.7 | Long. (o) | -98.594 | Alt. (m) | Depth (m) | 3933 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F009742 | Metagenome / Metatranscriptome | 313 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0247724_10455621 | F009742 | N/A | LRLPDVGAKEAVIFEQFGQLAGTTAYLHVHVELSISSVEAQLGKYRQLLKQNCDSELSVLNYMLTYVNTSITNFTLKKDFPDRPEDFPEKSMIRQNAKLWYKVAQLHLRDLEDMEESIATLRKSLPVVPNRNTGKIPVQAQYAPPQGAHVINMQAYSDTHDHLLTLIPEKSPMNLRTNSQGSVEMPEPRNVTRANPAVKTTGPTITKAGRSQGSRR |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |