Scaffold Ga0179589_10015193

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0179589_10015193

Scaffold Ga0179589_10015193

Overview

Basic Information
Taxon OID	3300024288 Open in IMG/M
Scaffold ID	Ga0179589_10015193 Open in IMG/M
Source Dataset Name	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2420
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	39.7291	Long. (^o)	-123.6419	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005058	Metagenome / Metatranscriptome	413	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0179589_100151935	F005058	GGAGG	MKRFVVVSILMLSVAMPSFCKTHKEMYSVSCSALWPAVKDALRNSGKYGILGIDSNEMTASFVIGGTLGGKRINSVVLNGKGDTCEMQVQTAYSGLAHNDAGDFKKRVDESLAQLKTAPAAEPKKPETTPPNQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.