NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255147_1015000

Scaffold Ga0255147_1015000


Overview

Basic Information
Taxon OID3300024289 Open in IMG/M
Scaffold IDGa0255147_1015000 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1661
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F000450Metagenome / Metatranscriptome1126Y
F068816Metagenome / Metatranscriptome124Y

Sequences

Protein IDFamilyRBSSequence
Ga0255147_10150001F000311N/APDRLSMEMAYWEAQIIGLDPHALSPLTFNIGTGSIEKVSRIRDKFNLTETYVSDYEPTGYTGR
Ga0255147_10150004F000450AGGAVGDRANFGFVQPNGETIVLYGHWAGYQMLGRLADAVIAARPRWNDPAYATRIAISQLIKDDWNSETGWGLHVNEISDNEHKIAIVDWKQQTFSLHEEDSHSNTDNKIRGMKNEALFTMDLSTFCEKYALDGMLVN
Ga0255147_10150005F068816AGGAMPNWCFNTLTIQGPKQEIDYIKDRLNKPFSVLHDSWNMDTREMEVKETHYSAPVFAFWNIHSPLEEGITMEEYVQQPSRLGIDPQDPEWFAKEIAHAKTQKDWYNWNTSNWGTKWDVAVRDD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.