NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228652_1017648

Scaffold Ga0228652_1017648


Overview

Basic Information
Taxon OID3300024326 Open in IMG/M
Scaffold IDGa0228652_1017648 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 64D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2115
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037983Metagenome167N

Sequences

Protein IDFamilyRBSSequence
Ga0228652_10176482F037983N/AMFLHRVLIEDCKVLTRVWWFDPTKLSEVKFVKKIHKQISDVFPDETYTYPVNHIYGMNHDDNNIIFHMCSPFEDEMKTLERKHALKAQHPILTGKAYTRYLYNMETKSKIFEVVYRDIENFGYENYPDPVVDVPSTVHINTVSEFYDEDFKYISQNILINGCDNIKAVYDFADSLNKDIPKPIPVDKWLHKDDLFKFVFDKYGHLISLQLWAHVDRVSIREKGEYRTEYKADYADCINNLDETEIVIPEYDDYGNSIKS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.