NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247668_1008607

Scaffold Ga0247668_1008607


Overview

Basic Information
Taxon OID3300024331 Open in IMG/M
Scaffold IDGa0247668_1008607 Open in IMG/M
Source Dataset NameSoil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2142
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)40.4449Long. (o)-87.0297Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000092Metagenome / Metatranscriptome2385Y
F004291Metagenome / Metatranscriptome445Y
F036398Metagenome / Metatranscriptome170Y

Sequences

Protein IDFamilyRBSSequence
Ga0247668_10086071F036398N/AFAGVTTYVGLRPGMHVWFGMDWDVTHSTGAVFMPVRRHISFGITQQFRMHLW
Ga0247668_10086072F004291AGGAGGMNRKNFALLALLGLLIAPAAQAQIKHIEMRVEGMT
Ga0247668_10086073F000092GAGVKQHLGRQSGVQNVEVSLIDGKVEVTPKEDGQIDPSQLLKATYDSGVTVAEMNMTAQGRVVKDSSGNFAIQVAPNRSFMLAPNELSKGLESLVDSPTLVTVRGQLYKKPAGKKKADASALLKLVIVEVQKKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.