NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0244777_10016123

Scaffold Ga0244777_10016123


Overview

Basic Information
Taxon OID3300024343 Open in IMG/M
Scaffold IDGa0244777_10016123 Open in IMG/M
Source Dataset NameCombined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4705
Total Scaffold Genes15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (6.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine → Estuarine Microbial Communities From The Columbia River Estuary, To Analyze Effect Of Nutrient Fluxes, A Time Series

Source Dataset Sampling Location
Location NameColumbia River Estuary, USA
CoordinatesLat. (o)46.234Long. (o)-123.9135Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013759Metagenome / Metatranscriptome268Y
F019136Metagenome / Metatranscriptome231Y
F031867Metagenome181N

Sequences

Protein IDFamilyRBSSequence
Ga0244777_1001612311F013759N/AMKIELGLSVLSKRETLLGVQLTTHNGVSVKDGELCSERVVEFSIGIIFAIFTIGFVSIGNKIETPDNVMKAIEAFESEMDKNK
Ga0244777_100161235F031867N/AMKIIYMQRTIEMIVKNEIELSADSLLNTKPTRVETHKEQNYLVYEFDNTELF
Ga0244777_100161236F019136N/AMSLTIQNYSKLESWSHNYKEFMIGEVIETETEYRFRVGYNGLPYTIKIFRQITISNECEIVLRDGADTTQYGREWINVRKLKSKELTAMIFETLIVKHKPKARGINNTFYNNGPF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.