NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255157_1060087

Scaffold Ga0255157_1060087


Overview

Basic Information
Taxon OID3300024355 Open in IMG/M
Scaffold IDGa0255157_1060087 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8h
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)609
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)31.4271Long. (o)-81.6053Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073113Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0255157_10600871F073113N/AQKKQTQKPMNEYSRPTLTPSYPSSQTMPPADREYPLLTKQNIHEGFIPAARGPNSDPLTIAPKGASATGFGPELDMMYQMPNGQTYPSEPSTGPYGTAFGYSSNQPPYAPQLISGIQPAPSPIDSNIPMTEYRSDNMESDPNYIGSDFVISPLSGQKIPSNEFKHNNMQPFFGGRIKQNMAPQANVSVLDAYNGNGSTQMKKR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.